PDB entry 1s7c

View 1s7c on RCSB PDB site
Description: Crystal structure of MES buffer bound form of glyceraldehyde 3-phosphate dehydrogenase from Escherichia coli
Class: structural genomics, oxidoreductase
Keywords: hypothetical, structural genomics, x-ray crytsallography, OXIDOREDUCTASE, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center
Deposited on 2004-01-29, released 2004-08-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.2
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyceraldehyde 3-phosphate dehydrogenase A
    Species: Escherichia coli [TaxId:562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1s7ca1, d1s7ca2
  • Heterogens: SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s7cA (A:)
    mtikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvev
    kdghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmt
    gpskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatt
    atqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsv
    vdltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagia
    lndnfvklvswydnetgysnkvldliahisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7cA (A:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk