PDB entry 1s7a

View 1s7a on RCSB PDB site
Description: NMR structure of the La motif of human La protein
Class: RNA binding protein, translation
Keywords: La motif, alpha/beta, winged helix domain
Deposited on 2004-01-29, released 2004-04-06
The last revision prior to the SCOP 1.75 freeze date was dated 2004-04-06, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lupus La protein
  Species: HOMO SAPIENS
  Gene: ssb
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05455 (0-102)
  Domains in SCOP 1.75: d1s7aa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1s7aA (A:)
  maengdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnr
  lttdfnvivealskskaelmeisedktkirrspskplpevtde