PDB entry 1s7a

View 1s7a on RCSB PDB site
Description: NMR structure of the La motif of human La protein
Class: RNA binding protein, translation
Keywords: La motif, alpha/beta, winged helix domain
Deposited on 2004-01-29, released 2004-04-06
The last revision prior to the SCOP 1.73 freeze date was dated 2004-04-06, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lupus La protein
    Species: HOMO SAPIENS
    Gene: ssb
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s7aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s7aA (A:)
    maengdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnr
    lttdfnvivealskskaelmeisedktkirrspskplpevtde