PDB entry 1s73

View 1s73 on RCSB PDB site
Description: Crystal Structure of Mesopone Cytochrome c Peroxidase (R-isomer) [MpCcP-R]
Class: oxidoreductase
Keywords: Bifunctional catalyst, proximal loop, Trp191 radical, mesoporphyrin, nitrite reductase, cyctochrome c peroxidase, cytochorme oxidase
Deposited on 2004-01-28, released 2005-06-14
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.183
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1s73a1
  • Heterogens: FMI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s73A (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl