PDB entry 1s71

View 1s71 on RCSB PDB site
Description: STRUCTURE OF tRNA PSI55 PSEUDOURIDINE SYNTHASE (TRUB)
Class: lyase
Keywords: tRNA modification
Deposited on 2004-01-28, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-03-02, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA pseudouridine synthase B
    Species: Mycobacterium tuberculosis
    Gene: TRUB, RV2793C, MT2862.1, MTV002.58C, MB2816C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s71a1, d1s71a2
  • Chain 'B':
    Compound: tRNA pseudouridine synthase B
    Species: Mycobacterium tuberculosis
    Gene: TRUB, RV2793C, MT2862.1, MTV002.58C, MB2816C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s71b1, d1s71b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s71A (A:)
    msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
    glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeirqvpss
    vsaikvggrrayrlarqgrsvqlearpiridrfellaarrrdqlididveidcssgtyir
    alardlgdalgvgghvtalrrtrvgrfeldqarslddlaerpalslsldeacllmfarrd
    ltaaeasaaangrslpavgidgvyaacdadgrviallrdegsrtrsvavlrpatmhpggv
    prgklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s71A (A:)
    atgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkilgl
    ltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeilearpiri
    drfellaarrrdqlididveidcssgtyiralardlgdalgvgghvtalrrtrvgrfeld
    qarslddlaerpalslsldeacllmfarrdltaaeasaaangrslpavgidgvyaacdad
    grviallrdegsrtrsvavlrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s71B (B:)
    msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
    glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeirqvpss
    vsaikvggrrayrlarqgrsvqlearpiridrfellaarrrdqlididveidcssgtyir
    alardlgdalgvgghvtalrrtrvgrfeldqarslddlaerpalslsldeacllmfarrd
    ltaaeasaaangrslpavgidgvyaacdadgrviallrdegsrtrsvavlrpatmhpggv
    prgklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s71B (B:)
    msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
    glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrsvqlearpi
    ridrfellaarrrdqlididveidcssgtyiralardlgdalgvgghvtalrrtrvgrfe
    ldqarslddlaerpalslsldeacllmfarrdltaaeasaaangrslpavgidgvyaacd
    adgrviallrdegsrtrsvavlrpat