PDB entry 1s6v

View 1s6v on RCSB PDB site
Description: Structure of a cytochrome c peroxidase-cytochrome c site specific cross-link
Deposited on 2004-01-27, released 2004-04-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.19
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1s6va_
  • Chain 'B':
    Domains in SCOP 1.69: d1s6vb_
  • Chain 'C':
    Domains in SCOP 1.69: d1s6vc_
  • Chain 'D':
    Domains in SCOP 1.69: d1s6vd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6vA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwragrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaanncftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6vB (B:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmcfgglkkekdrndlitylkkate
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6vC (C:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwragrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaanncftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6vD (D:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmcfgglkkekdrndlitylkkate