PDB entry 1s6v

View 1s6v on RCSB PDB site
Description: Structure of a cytochrome c peroxidase-cytochrome c site specific cross-link
Class: oxidoreductase/electron transport
Keywords: OXIDOREDUCTASE, heme enzyme, electron transfer, OXIDOREDUCTASE/ELECTRON TRANSPORT COMPLEX
Deposited on 2004-01-27, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.19
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-293)
      • engineered (127)
      • engineered (196)
    Domains in SCOPe 2.07: d1s6va_
  • Chain 'B':
    Compound: cytochrome c, iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • see remark 999 (0)
      • engineered (85)
      • engineered (106)
    Domains in SCOPe 2.07: d1s6vb_
  • Chain 'C':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-293)
      • engineered (127)
      • engineered (196)
    Domains in SCOPe 2.07: d1s6vc_
  • Chain 'D':
    Compound: cytochrome c, iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • see remark 999 (0)
      • engineered (85)
      • engineered (106)
    Domains in SCOPe 2.07: d1s6vd_
  • Heterogens: IOD, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6vA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwragrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaanncftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6vB (B:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmcfgglkkekdrndlitylkkate
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6vC (C:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwragrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaanncftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6vD (D:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmcfgglkkekdrndlitylkkate