PDB entry 1s6n

View 1s6n on RCSB PDB site
Description: NMR Structure of Domain III of the West Nile Virus Envelope Protein, Strain 385-99
Class: Viral protein
Keywords: beta barrel, flavivirus
Deposited on 2004-01-26, released 2004-07-06
The last revision prior to the SCOP 1.73 freeze date was dated 2004-09-28, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Envelope glycoprotein
  Species: West Nile virus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q913C7 (5-111)
    • see remark 999 (0-4)
    • see remark 999 (112-114)
  Domains in SCOP 1.73: d1s6na_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1s6nA (A:)
  isefqlkgttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltp
  vgrlvtvnpfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhksgssigk