PDB entry 1s6m

View 1s6m on RCSB PDB site
Description: Conjugative Relaxase Trwc In Complex With Orit DNA. Metal-Bound Structure
Class: DNA binding protein/DNA
Keywords: protein-dna complex, bacterial conjugation, relaxase, dna replication, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2004-01-26, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-12-30, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.206
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TrwC
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47673 (0-292)
      • modified residue (0)
      • modified residue (4)
      • modified residue (69)
      • modified residue (168)
    Domains in SCOPe 2.08: d1s6ma_
  • Chain 'B':
    Compound: DNA (25-mer)
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s6mA (A:)
    mlshmvltrqdigraasyyedgaddyyakdgdasewqgkgaeelglsgevdskrfrella
    gnigeghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleq
    aearaqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwral
    kndeivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqia
    ewyaargldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s6mA (A:)
    mlshmvltrqdigraasyyedgaddydasewqgkgaeelglsgevdskrfrellagnige
    ghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleqaeara
    qarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwralkndei
    vkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqiaewyaa
    rgldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
    

  • Chain 'B':
    No sequence available.