PDB entry 1s6i

View 1s6i on RCSB PDB site
Description: Ca2+-regulatory region (CLD) from soybean calcium-dependent protein kinase-alpha (CDPK) in the presence of Ca2+ and the junction domain (JD)
Class: transferase, plant protein
Keywords: EF-hand; helix-loop-helix; calcium-binding; calmodulin superfamily, TRANSFERASE, PLANT PROTEIN
Deposited on 2004-01-23, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-dependent protein kinase SK5
    Species: Glycine max [TaxId:3847]
    Gene: CDPK SK5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28583 (0-181)
      • insertion (142-143)
    Domains in SCOPe 2.08: d1s6ia_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s6iA (A:)
    aerlseeeigglkelfkmidtdnsgtitfdelkdglkrvgselmeseikdlmdaadidks
    gtidygefiaatvhlnklereenlvsafsyfdkdgsgyitldeiqqackdfglddihidd
    mikeidqdndgqidygefaammrkrkgnggigrrtmrktlnlrdalglvdngsnqviegy
    fkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s6iA (A:)
    aerlseeeigglkelfkmidtdnsgtitfdelkdglkrvgselmeseikdlmdaadidks
    gtidygefiaatvhlnklereenlvsafsyfdkdgsgyitldeiqqackdfglddihidd
    mikeidqdndgqidygefaammrkrkgnggigrrtmrktlnlrdalglvdngsnqviegy
    fk