PDB entry 1s6d

View 1s6d on RCSB PDB site
Description: Structure in solution of a methionine-rich 2S Albumin protein from Sunflower Seed
Class: plant protein
Keywords: all helix, folded leaf, right-handed superhelix, disulphide rich, plant protein
Deposited on 2004-01-23, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Albumin 8
  Species: Helianthus annuus [TaxId:4232]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23110 (0-102)
  Domains in SCOPe 2.07: d1s6da_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1s6dA (A:)
  pygrgrtesgcyqqmeeaemlnhcgmylmknlgersqvsprmreedhkqlccmqlknlde
  kcmcpaimmmlnepmwirmrdqvmsmahnlpiecnlmsqpcqm