PDB entry 1s6b

View 1s6b on RCSB PDB site
Description: X-ray Crystal Structure of a Complex Formed Between Two Homologous Isoforms of Phospholipase A2 from Naja naja sagittifera: Principle of Molecular Association and Inactivation
Class: hydrolase
Keywords: Phospholipase A2, molecular conformation, enzyme activity, HYDROLASE
Deposited on 2004-01-23, released 2004-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.212
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 1
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s6ba_
  • Chain 'B':
    Compound: Phospholipase A2 isoform 2
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s6bb_
  • Heterogens: CA, PO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6bA (A:)
    ntyqfknmiqctvpkrswwdfadygcycgrggsgtpiddldrccqvhdncynsareqggc
    rpkqktysyeckagtlscsgsnnscaatvcdcdrlaaicfagapyndnnynidlkarcq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s6bB (B:)
    nrwqfknmisctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
    nprfrtysyectagtltctgrnnacaasvcdcdrlaaicfagapyndnnynidlqarcn