PDB entry 1s6b
View 1s6b on RCSB PDB site
Description: X-ray Crystal Structure of a Complex Formed Between Two Homologous Isoforms of Phospholipase A2 from Naja naja sagittifera: Principle of Molecular Association and Inactivation
Class: hydrolase
Keywords: Phospholipase A2, molecular conformation, enzyme activity, HYDROLASE
Deposited on
2004-01-23, released
2004-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.212
AEROSPACI score: 0.55
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Phospholipase A2 isoform 1
Species: Naja sagittifera [TaxId:195058]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1s6ba_ - Chain 'B':
Compound: Phospholipase A2 isoform 2
Species: Naja sagittifera [TaxId:195058]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1s6bb_ - Heterogens: CA, PO4, ACY, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1s6bA (A:)
ntyqfknmiqctvpkrswwdfadygcycgrggsgtpiddldrccqvhdncynsareqggc
rpkqktysyeckagtlscsgsnnscaatvcdcdrlaaicfagapyndnnynidlkarcq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1s6bB (B:)
nrwqfknmisctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
nprfrtysyectagtltctgrnnacaasvcdcdrlaaicfagapyndnnynidlqarcn