PDB entry 1s69

View 1s69 on RCSB PDB site
Description: The X-ray structure of the cyanobacteria Synechocystis hemoglobin "cyanoglobin" with cyanide ligand
Deposited on 2004-01-22, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.193
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1s69a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s69A (A:)
    mstlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdk
    ydgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrd
    vlnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s69A (A:)
    stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
    dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
    lnq