PDB entry 1s68

View 1s68 on RCSB PDB site
Description: Structure and Mechanism of RNA Ligase
Class: ligase
Keywords: ribonucleic acid ligase, RNA repair, t4
Deposited on 2004-01-22, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA Ligase 2
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: Y10A, 24.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s68a_
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s68A (A:)
    mfkkysslenhynskfieklyslgltggewvarekihgtnfsliierdkvtcakrtgpil
    paedffgyeiilknyadsikavqdimetsavvsyqvfgefagpgiqknvdycdkdfyvfd
    iivttesgdvtyvddymmesfcntfkfkmapllgrgkfeeliklpndldsvvqdynftvd
    haglvdankcvwnaeakgevftaegyvlkpcypswlrngnrvaikcknskfsekkksdkp
    ikakvelse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s68A (A:)
    mfkkysslenhynskfieklyslgltggewvarekihgtnfsliierdkvtcakrtgpil
    paedffgyeiilknyadsikavqdimetsavvsyqvfgefagpgiqknvdycdkdfyvfd
    iivttesgdvtyvddymmesfcntfkfkmapllgrgkfeeliklpndldsvvqdynftvd
    haglvdankcvwnaeakgevftaegyvlkpcypswlrngnrvaikcknskfse