PDB entry 1s67

View 1s67 on RCSB PDB site
Description: Crystal structure of heme domain of direct oxygen sensor from E. coli
Class: oxygen storage/transport
Keywords: oxygen storage/transport, heme, e.coli
Deposited on 2004-01-22, released 2004-06-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.197
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: Hypothetical protein yddU
    Species: Escherichia coli [TaxId:562]
    Gene: YDDU, B1489
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1s67l_
  • Chain 'U':
    Compound: Hypothetical protein yddU
    Species: Escherichia coli [TaxId:562]
    Gene: YDDU, B1489
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1s67u_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s67L (L:)
    naadgiffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrp
    ahpeyirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrdas
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1s67U (U:)
    naadgiffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrp
    ahpeyirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrdas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s67U (U:)
    giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
    yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrdas