PDB entry 1s67

View 1s67 on RCSB PDB site
Description: Crystal structure of heme domain of direct oxygen sensor from E. coli
Deposited on 2004-01-22, released 2004-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.197
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Domains in SCOP 1.69: d1s67l_
  • Chain 'U':
    Domains in SCOP 1.69: d1s67u_

PDB Chain Sequences:

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s67L (L:)
    naadgiffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrp
    ahpeyirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrdas
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1s67U (U:)
    naadgiffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrp
    ahpeyirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrdas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s67U (U:)
    giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
    yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrdas