PDB entry 1s65

View 1s65 on RCSB PDB site
Description: Crystal Structure Analysis of HIV-1 Protease Mutant V82A with a Potent Non-peptide Inhibitor (UIC-94017)
Class: hydrolase
Keywords: hiv-1 protease, mutant, dimer, inhibitor, uic-94017
Deposited on 2004-01-22, released 2004-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.117
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (81)
      • engineered (94)
    Domains in SCOPe 2.08: d1s65a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (81)
      • engineered (94)
    Domains in SCOPe 2.08: d1s65b_
  • Heterogens: CL, PO4, 017, DMS, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s65A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s65B (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf