PDB entry 1s64

View 1s64 on RCSB PDB site
Description: Rat protein geranylgeranyltransferase type-I complexed with L-778,123 and a sulfate anion
Class: transferase
Keywords: L-778,123, protein geranylgeranyltransferase type-I, protein prenylation, lipid modification, drug
Deposited on 2004-01-22, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.192
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s64a_
  • Chain 'B':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s64b_
  • Chain 'C':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s64c_
  • Chain 'D':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s64d_
  • Chain 'E':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s64e_
  • Chain 'F':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s64f_
  • Chain 'G':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s64g_
  • Chain 'H':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s64h_
  • Chain 'I':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s64i_
  • Chain 'J':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s64j_
  • Chain 'K':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s64k_
  • Chain 'L':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s64l_
  • Heterogens: ZN, CL, SO4, 778, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s64A (A:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s64A (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s64B (B:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s64B (B:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s64C (C:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s64C (C:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s64D (D:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s64D (D:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s64E (E:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s64E (E:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s64F (F:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s64F (F:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s64G (G:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s64G (G:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s64H (H:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s64H (H:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1s64I (I:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s64I (I:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1s64J (J:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s64J (J:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1s64K (K:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s64K (K:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1s64L (L:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s64L (L:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt