PDB entry 1s62

View 1s62 on RCSB PDB site
Description: Solution structure of the Escherichia coli TolA C-terminal domain
Class: protein transport
Keywords: tol g3p interaction, PROTEIN TRANSPORT
Deposited on 2004-01-22, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TolA protein
    Species: Escherichia coli [TaxId:562]
    Gene: TOLA, CIM, EXCC, LKY, B0739
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19934 (3-99)
      • cloning artifact (0-2)
      • expression tag (100-101)
    Domains in SCOPe 2.07: d1s62a2, d1s62a3, d1s62a4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s62A (A:)
    aefgntknngasgadinnyagqiksaieskfydassyagktctlriklapdgmlldikpe
    ggdpalcqaalaaaklakipkppsqavyevfknapldfkphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s62A (A:)
    aefgntknngasgadinnyagqiksaieskfydassyagktctlriklapdgmlldikpe
    ggdpalcqaalaaaklakipkppsqavyevfknapldfkphh