PDB entry 1s60

View 1s60 on RCSB PDB site
Description: Aminoglycoside N-Acetyltransferase AAC(6')-Iy in Complex with CoA and N-terminal His(6)-tag (crystal form 2)
Deposited on 2004-01-22, released 2004-05-18
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-18, with a file datestamp of 2004-05-18.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1s60a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s60A (A:)
    mgsshhhhhhssglvprgshmdirqmnkthlehwrglrkqlwpghpddahladgeeilqa
    dhlasfiamadgvaigfadasirhdyvngcdsspvvflegifvlpsfrqrgvakqliaav
    qrwgtnkgcremasdtspentisqkvhqalgfeetervifyrkrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s60A (A:)
    lvprgshmdirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgv
    aigfadasirhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcrema
    sdtspentisqkvhqalgfeetervifyrkrc