PDB entry 1s60

View 1s60 on RCSB PDB site
Description: Aminoglycoside N-Acetyltransferase AAC(6')-Iy in Complex with CoA and N-terminal His(6)-tag (crystal form 2)
Class: transferase
Keywords: GNAT, N-acetyltransferase, acetyltransferase, aminoglycoside, CoA, transferase
Deposited on 2004-01-22, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminoglycoside 6'-N-acetyltransferase
    Species: Salmonella enteritidis [TaxId:592]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R381 (20-164)
      • expression tag (13-19)
    Domains in SCOPe 2.08: d1s60a1, d1s60a2
  • Heterogens: SO4, COA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s60A (A:)
    mgsshhhhhhssglvprgshmdirqmnkthlehwrglrkqlwpghpddahladgeeilqa
    dhlasfiamadgvaigfadasirhdyvngcdsspvvflegifvlpsfrqrgvakqliaav
    qrwgtnkgcremasdtspentisqkvhqalgfeetervifyrkrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s60A (A:)
    lvprgshmdirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgv
    aigfadasirhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcrema
    sdtspentisqkvhqalgfeetervifyrkrc