PDB entry 1s5z

View 1s5z on RCSB PDB site
Description: NDP kinase in complex with adenosine phosphonoacetic acid
Class: transferase
Keywords: transferase
Deposited on 2004-01-22, released 2005-02-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: NDKC, NDKB, GIP17, DD_02290, DD_02289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1s5za_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: NDKC, NDKB, GIP17, DD_02290, DD_02289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1s5zb_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: NDKC, NDKB, GIP17, DD_02290, DD_02289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1s5zc_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: NDKC, NDKB, GIP17, DD_02290, DD_02289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1s5zd_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: NDKC, NDKB, GIP17, DD_02290, DD_02289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1s5ze_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: NDKC, NDKB, GIP17, DD_02290, DD_02289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1s5zf_
  • Heterogens: PO4, SON, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s5zA (A:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    ihgsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5zA (A:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s5zB (B:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    ihgsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5zB (B:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s5zC (C:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    ihgsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5zC (C:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s5zD (D:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    ihgsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5zD (D:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s5zE (E:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    ihgsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5zE (E:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s5zF (F:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    ihgsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5zF (F:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye