PDB entry 1s5y

View 1s5y on RCSB PDB site
Description: The crystal structure of Trematomus bernacchii hemoglobin oxidized by ferricyanide
Class: oxygen storage/transport
Keywords: Hemichrome, bis-histidine, oxidation
Deposited on 2004-01-22, released 2004-05-04
The last revision prior to the SCOP 1.73 freeze date was dated 2004-05-04, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha chain
    Species: Pagothenia bernacchii
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s5ya_
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: Pagothenia bernacchii
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s5yb_
  • Chain 'C':
    Compound: hemoglobin alpha chain
    Species: Pagothenia bernacchii
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s5yc_
  • Chain 'D':
    Compound: hemoglobin beta chain
    Species: Pagothenia bernacchii
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s5yd_
  • Heterogens: ACE, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5yA (A:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s5yB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5yB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgaiignanvaahgikvl
    hgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmghaftaetqg
    afqkflavvvsalgkq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5yC (C:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s5yD (D:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5yD (D:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgaiignanvaahgikvl
    hgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmghaftaetqg
    afqkflavvvsalgkq