PDB entry 1s5x

View 1s5x on RCSB PDB site
Description: The crystal structure of Trematomus bernacchii hemoglobin oxidized by air
Class: oxygen storage/transport
Keywords: Hemichrome, bis-histidine, oxidation, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2004-01-22, released 2004-05-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha chain
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1s5xa_
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1s5xb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5xA (A:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s5xB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5xB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgaiignanvaahgikvl
    hgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmghaftaetqg
    afqkflavvvsalgkq