PDB entry 1s5r

View 1s5r on RCSB PDB site
Description: Solution Structure of HBP1 SID-mSin3A PAH2 Complex
Class: transcription
Keywords: Protein-peptide complex, Amphipathic helix motif, Four-helix bundle, Repressor-corepressor complex, TRANSCRIPTION
Deposited on 2004-01-21, released 2004-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: high mobility group box transcription factor 1
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8BUS3 (0-22)
  Domains in SCOPe 2.08: d1s5ra_
• Chain 'B':
  Compound: Sin3a protein
  Species: Mus musculus [TaxId:10090]
  Gene: Sin3A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60520 (0-88)
  Domains in SCOPe 2.08: d1s5rb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1s5rA (A:)
  dftpmdssavyvlssmarqrras
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1s5rB (B:)
  slqnnqpvefnhainyvnkiknrfqgqpdiykafleilhtyqkeqrnakeaggnytpalt
  eqevyaqvarlfknqedllsefgqflpda