PDB entry 1s5p

View 1s5p on RCSB PDB site
Description: Structure and substrate binding properties of cobB, a Sir2 homolog protein deacetylase from Eschericia coli.
Class: hydrolase
Keywords: protein deacetylase, Sir2 homologue
Deposited on 2004-01-21, released 2004-03-23
The last revision prior to the SCOP 1.73 freeze date was dated 2004-03-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.234
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase
    Species: Escherichia coli
    Gene: NPDA, COBB, B1120
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s5pa_
  • Chain 'B':
    Compound: histone h4 (residues 12-19)
    Species: synthetic, synthetic
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s5pA (A:)
    kprvlvltgagisaesgirtfraadglweehrvedvatpegfdrdpelvqafynarrrql
    qqpeiqpnaahlalaklqdalgdrfllvtqnidnlheragntnvihmhgellkvrcsqsg
    qvldwtgdvtpedkchccqfpaplrphvvwfgemplgmdeiymalsmadifiaigtsghv
    ypaagfvheaklhgahtvelnlepsqvgnefaekyygpasqvvpefvekllkglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5pA (A:)
    kprvlvltgagisaesgirtfraadglweehrvedvatpegfdrdpelvqafynarrrql
    qqpeiqpnaahlalaklqdalgdrfllvtqnidnlheragntnvihmhgellkvrcsqsg
    qvldwtgdvtpedkcplrphvvwfgemplgmdeiymalsmadifiaigtsghvypaagfv
    heaklhgahtvelnlepsqefaekyygpasqvvpefvekllkglk
    

  • Chain 'B':
    No sequence available.