PDB entry 1s5l

View 1s5l on RCSB PDB site
Description: architecture of the photosynthetic oxygen evolving center
Deposited on 2004-01-21, released 2004-02-24
The last revision was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photosystem Q(B) protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Photosystem II core light harvesting protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Photosystem II CP43 protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Photosystem II reaction center D2 protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: cytochrome b559 alpha subunit
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: cytochrome b559 beta subunit
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: photosystem II PsbH protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Photosystem II reaction center I protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Photosystem II reaction center J protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Photosystem II reaction center protein K
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Photosystem II reaction center L protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Photosystem II reaction center M protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Photosystem II PsbN protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
    • PDB 1S5L
  • Chain 'O':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: photosystem II PsbT protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: cytochrome c-550
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Photosystem II PsbX protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Photosystem II reaction center Z protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: Photosystem Q(B) protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Photosystem II core light harvesting protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Photosystem II CP43 protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Photosystem II reaction center D2 protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: cytochrome b559 alpha subunit
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: cytochrome b559 beta subunit
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: photosystem II PsbH protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Photosystem II reaction center I protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Photosystem II reaction center J protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Photosystem II reaction center protein K
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Photosystem II reaction center L protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Photosystem II reaction center M protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: Photosystem II PsbN protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
    • PDB 1S5L (0-36)
  • Chain 'o':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: photosystem II PsbT protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: cytochrome c-550
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: Photosystem II PsbX protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'z':
    Compound: Photosystem II reaction center Z protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, BCT, OEC, CLA, PHO, PL9, LMT, BCR, HEC

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1s5lA (A:)
    mtttlqrresanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdi
    dgirepvsgsllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfl
    lgascymgrqwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtf
    nfmivfqaehnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfg
    qeeetynivaahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngf
    nfnhsvidakgnvintwadiinranlgmevmhernahnfpldla
    

    Sequence, based on observed residues (ATOM records):
    >1s5lA (A:)
    nlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgsl
    lygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrqw
    elsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaehn
    ilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetynivaa
    hgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidakg
    nvintwadiinranlgmevmhernahnfpldla
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1s5lB (B:)
    mglpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgm
    fvlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdl
    elfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqp
    vapewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlss
    siaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatlee
    awsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmp
    affesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksy
    arkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfs
    gidpelspeqvewgfyqkvgdvttrrkeav
    

    Sequence, based on observed residues (ATOM records):
    >1s5lB (B:)
    yrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmfvlpf
    marlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdlelfrd
    prtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpvapew
    gpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsssiaav
    ffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleeawsai
    peklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpaffes
    fpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksyarkai
    fgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1s5lC (C:)
    mktlssqkryspvvtlssnsifatnrdqessgfawwagnarlinlsgkllgahvahagli
    vfwagamtlfelahfipekpmyeqgliliphiatlgwgvgpggevvdtfpffvvgvvhli
    ssavlgfggvyhairgpetleeyssffgydwkdknkmttilgfhlivlgigalllvakam
    ffgglydtwapgggdvrvitnptldprvifgyllkspfggegwivsvnnledvvgghiwi
    gliciaggiwhilttpfgwarrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypse
    fygptgpeasqaqamtflirdqklganvgsaqgptglgkylmrsptgeiifggetmrfwd
    frgpwleplrgpngldlnkikndiqpwqerraaeymthaplgslnsvggvateinsvnfv
    sprswlatshfvlaffflvghlwhagraraaaagfekgidresepvlsmpsld
    

    Sequence, based on observed residues (ATOM records):
    >1s5lC (C:)
    wagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqgliliphiatl
    gwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyssffgydwkdkn
    kmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptldprvifgyllk
    spfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafiwsgeaylsys
    lgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklganvgsaqgpt
    glgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiqpwqerraaey
    mthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwhagraraaaagf
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1s5lD (D:)
    mtiaigrapaergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswyt
    hglassylegcnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgaf
    gligfmlrqfeiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifr
    fllffqgfhnwtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqa
    eetysmvtanrfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfis
    qeiraaedpefetfytknlllnegirawmapqdqphenfvfpeevlprgnal
    

    Sequence, based on observed residues (ATOM records):
    >1s5lD (D:)
    wfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcnf
    ltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfeia
    rlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwtl
    npfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrfw
    sqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefet
    fytknlllnegirawmapqdqphenfvfpeevlprgnal
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1s5lE (E:)
    magttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeq
    rsiplvtdrfeakqqvetfleqlk
    

    Sequence, based on observed residues (ATOM records):
    >1s5lE (E:)
    pfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsiplvtd
    rfeakqqvetfleqlk
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1s5lF (F:)
    mtsntpnqepvsypiftvrwvavhtlavptifflgaiaamqfiqr
    

    Sequence, based on observed residues (ATOM records):
    >1s5lF (F:)
    ypiftvrwvavhtlavptifflgaiaamqfiqr
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1s5lH (H:)
    marrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnv
    swkalg
    

    Sequence, based on observed residues (ATOM records):
    >1s5lH (H:)
    lnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvswkalg
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1s5lI (I:)
    metlkitvyivvtffvllfvfgflsgdparnpkrkdle
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1s5lJ (J:)
    mmseggriplwivatvagmgvivivglffygayaglgssl
    

    Sequence, based on observed residues (ATOM records):
    >1s5lJ (J:)
    seggriplwivatvagmgvivivglffygayaglgssl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >1s5lK (K:)
    klpeayaifdplvdvlpvipvlflalafvwqaavgfr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >1s5lL (L:)
    mepnpnrqpvelnrtslylglllilvlallfssyffn
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1s5lM (M:)
    mevnqlgliatalfvlvpsvfliilyvqtesqqkss
    

    Sequence, based on observed residues (ATOM records):
    >1s5lM (M:)
    mevnqlgliatalfvlvpsvfliilyvqte
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records:
    >1s5lN (N:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >1s5lO (O:)
    akqtltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkr
    qeaefvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllf
    tvknlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakee
    elaranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfy
    asiepa
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >1s5lT (T:)
    metityvfifaciialfffaiffreppritkk
    

    Sequence, based on observed residues (ATOM records):
    >1s5lT (T:)
    metityvfifaciialfffaiffreppritk
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >1s5lU (U:)
    mqrlgrwlalayfvgvsllgwinwsaptlaatasteeelvnvvdeklgtaygekidlnnt
    niaafiqyrglyptlaklivknapyesvedvlnipglterqkqilrenlehftvteveta
    lveggdrynnglyk
    

    Sequence, based on observed residues (ATOM records):
    >1s5lU (U:)
    aatasteeelvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesve
    dvlnipglterqkqilrenlehftvtevetalveggdrynnglyk
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records:
    >1s5lV (V:)
    aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
    latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
    vepkilgdkwgggkvyy
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >1s5lX (X:)
    miqsassllltitpslkgffigllsgavvlgltfavliaisqidkvqrsl
    

    Sequence, based on observed residues (ATOM records):
    >1s5lX (X:)
    titpslkgffigllsgavvlgltfavliaisqidkvqrsl
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >1s5lZ (Z:)
    mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
    vv
    

    Sequence, based on observed residues (ATOM records):
    >1s5lZ (Z:)
    mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvln
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >1s5la (a:)
    mtttlqrresanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdi
    dgirepvsgsllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfl
    lgascymgrqwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtf
    nfmivfqaehnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfg
    qeeetynivaahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngf
    nfnhsvidakgnvintwadiinranlgmevmhernahnfpldla
    

    Sequence, based on observed residues (ATOM records):
    >1s5la (a:)
    nlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgsl
    lygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrqw
    elsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaehn
    ilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetynivaa
    hgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidakg
    nvintwadiinranlgmevmhernahnfpldla
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >1s5lb (b:)
    mglpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgm
    fvlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdl
    elfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqp
    vapewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlss
    siaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatlee
    awsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmp
    affesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksy
    arkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfs
    gidpelspeqvewgfyqkvgdvttrrkeav
    

    Sequence, based on observed residues (ATOM records):
    >1s5lb (b:)
    yrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmfvlpf
    marlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdlelfrd
    prtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpvapew
    gpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsssiaav
    ffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleeawsai
    peklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpaffes
    fpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksyarkai
    fgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >1s5lc (c:)
    mktlssqkryspvvtlssnsifatnrdqessgfawwagnarlinlsgkllgahvahagli
    vfwagamtlfelahfipekpmyeqgliliphiatlgwgvgpggevvdtfpffvvgvvhli
    ssavlgfggvyhairgpetleeyssffgydwkdknkmttilgfhlivlgigalllvakam
    ffgglydtwapgggdvrvitnptldprvifgyllkspfggegwivsvnnledvvgghiwi
    gliciaggiwhilttpfgwarrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypse
    fygptgpeasqaqamtflirdqklganvgsaqgptglgkylmrsptgeiifggetmrfwd
    frgpwleplrgpngldlnkikndiqpwqerraaeymthaplgslnsvggvateinsvnfv
    sprswlatshfvlaffflvghlwhagraraaaagfekgidresepvlsmpsld
    

    Sequence, based on observed residues (ATOM records):
    >1s5lc (c:)
    wagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqgliliphiatl
    gwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyssffgydwkdkn
    kmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptldprvifgyllk
    spfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafiwsgeaylsys
    lgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklganvgsaqgpt
    glgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiqpwqerraaey
    mthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwhagraraaaagf
    e
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >1s5ld (d:)
    mtiaigrapaergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswyt
    hglassylegcnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgaf
    gligfmlrqfeiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifr
    fllffqgfhnwtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqa
    eetysmvtanrfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfis
    qeiraaedpefetfytknlllnegirawmapqdqphenfvfpeevlprgnal
    

    Sequence, based on observed residues (ATOM records):
    >1s5ld (d:)
    wfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcnf
    ltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfeia
    rlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwtl
    npfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrfw
    sqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefet
    fytknlllnegirawmapqdqphenfvfpeevlprgnal
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >1s5le (e:)
    magttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeq
    rsiplvtdrfeakqqvetfleqlk
    

    Sequence, based on observed residues (ATOM records):
    >1s5le (e:)
    pfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsiplvtd
    rfeakqqvetfleqlk
    

  • Chain 'f':
    Sequence, based on SEQRES records:
    >1s5lf (f:)
    mtsntpnqepvsypiftvrwvavhtlavptifflgaiaamqfiqr
    

    Sequence, based on observed residues (ATOM records):
    >1s5lf (f:)
    ypiftvrwvavhtlavptifflgaiaamqfiqr
    

  • Chain 'h':
    Sequence, based on SEQRES records:
    >1s5lh (h:)
    marrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnv
    swkalg
    

    Sequence, based on observed residues (ATOM records):
    >1s5lh (h:)
    lnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvswkalg
    

  • Chain 'i':
    Sequence; same for both SEQRES and ATOM records:
    >1s5li (i:)
    metlkitvyivvtffvllfvfgflsgdparnpkrkdle
    

  • Chain 'j':
    Sequence, based on SEQRES records:
    >1s5lj (j:)
    mmseggriplwivatvagmgvivivglffygayaglgssl
    

    Sequence, based on observed residues (ATOM records):
    >1s5lj (j:)
    seggriplwivatvagmgvivivglffygayaglgssl
    

  • Chain 'k':
    Sequence; same for both SEQRES and ATOM records:
    >1s5lk (k:)
    klpeayaifdplvdvlpvipvlflalafvwqaavgfr
    

  • Chain 'l':
    Sequence; same for both SEQRES and ATOM records:
    >1s5ll (l:)
    mepnpnrqpvelnrtslylglllilvlallfssyffn
    

  • Chain 'm':
    Sequence, based on SEQRES records:
    >1s5lm (m:)
    mevnqlgliatalfvlvpsvfliilyvqtesqqkss
    

    Sequence, based on observed residues (ATOM records):
    >1s5lm (m:)
    mevnqlgliatalfvlvpsvfliilyvqte
    

  • Chain 'n':
    Sequence; same for both SEQRES and ATOM records:
    >1s5ln (n:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'o':
    Sequence; same for both SEQRES and ATOM records:
    >1s5lo (o:)
    akqtltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkr
    qeaefvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllf
    tvknlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakee
    elaranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfy
    asiepa
    

  • Chain 't':
    Sequence, based on SEQRES records:
    >1s5lt (t:)
    metityvfifaciialfffaiffreppritkk
    

    Sequence, based on observed residues (ATOM records):
    >1s5lt (t:)
    metityvfifaciialfffaiffreppritk
    

  • Chain 'u':
    Sequence, based on SEQRES records:
    >1s5lu (u:)
    mqrlgrwlalayfvgvsllgwinwsaptlaatasteeelvnvvdeklgtaygekidlnnt
    niaafiqyrglyptlaklivknapyesvedvlnipglterqkqilrenlehftvteveta
    lveggdrynnglyk
    

    Sequence, based on observed residues (ATOM records):
    >1s5lu (u:)
    aatasteeelvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesve
    dvlnipglterqkqilrenlehftvtevetalveggdrynnglyk
    

  • Chain 'v':
    Sequence; same for both SEQRES and ATOM records:
    >1s5lv (v:)
    aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
    latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
    vepkilgdkwgggkvyy
    

  • Chain 'x':
    Sequence, based on SEQRES records:
    >1s5lx (x:)
    miqsassllltitpslkgffigllsgavvlgltfavliaisqidkvqrsl
    

    Sequence, based on observed residues (ATOM records):
    >1s5lx (x:)
    titpslkgffigllsgavvlgltfavliaisqidkvqrsl
    

  • Chain 'z':
    Sequence, based on SEQRES records:
    >1s5lz (z:)
    mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
    vv
    

    Sequence, based on observed residues (ATOM records):
    >1s5lz (z:)
    mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvln