PDB entry 1s5i

View 1s5i on RCSB PDB site
Description: Fab (LNKB-2) of monoclonal antibody to Human Interleukin-2, crystal structure
Class: immune system
Keywords: monoclonal antibody, antigen-binding fragment, interleukin-2, x-ray analysis, crystal structure, IMMUNE SYSTEM
Deposited on 2004-01-21, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2
AEROSPACI score: -1.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab-fragment of monoclonal antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s5ih1, d1s5ih2
  • Chain 'L':
    Compound: Fab-fragment of monoclonal antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1S5I (0-218)
    Domains in SCOPe 2.07: d1s5il1, d1s5il2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5iH (H:)
    gvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgstgy
    npslksrisitrdtsknqfflqlnsvttedtatyycasyddytwftywgqgtlvtvsaak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5iL (L:)
    dvqmtqtpltlsvtigqpasiscessqsllysngktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlrisrveaedlgvyycvqgthfprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec