PDB entry 1s5h

View 1s5h on RCSB PDB site
Description: Potassium Channel Kcsa-Fab Complex T75C mutant in K+
Class: membrane protein
Keywords: K+ CHANNEL, PROTEIN-ANTIBODY FAB COMPLEX, selectivity filter, ion occupancy, MEMBRANE PROTEIN
Deposited on 2004-01-20, released 2004-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.222
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1S5H (0-End)
    Domains in SCOPe 2.06: d1s5ha1, d1s5ha2
  • Chain 'B':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1S5H (0-218)
    Domains in SCOPe 2.06: d1s5hb1, d1s5hb2
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces coelicolor, Streptomyces lividans [TaxId:1902,1916]
    Gene: KCSA, SKC1, SCO7660, SC10F4.33
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54397 (Start-123)
      • engineered (74)
    Domains in SCOPe 2.06: d1s5hc_
  • Heterogens: K, DGA, F09, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s5hA (A:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5hA (A:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5hB (B:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s5hC (C:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetatcvgygdlypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqe
    rrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5hC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetatcvgygdl
    ypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerrgh