PDB entry 1s5g

View 1s5g on RCSB PDB site
Description: Structure of Scallop myosin S1 reveals a novel nucleotide conformation
Class: contractile protein
Keywords: Scallop myosin S1, Near Rigor, complex salt bridge, novel conformation of nucleotide
Deposited on 2004-01-20, released 2004-06-22
The last revision prior to the SCOP 1.75 freeze date was dated 2004-06-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.233
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin heavy chain, striated muscle
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1s5ga1, d1s5ga2
  • Chain 'Y':
    Compound: myosin regulatory light chain, striated adductor muscle
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1s5gy_
  • Chain 'Z':
    Compound: myosin essential light chain, striated adductor muscle
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1s5gz_
  • Heterogens: SO4, CA, MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s5gA (A:)
    mnidfsdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvki
    vadsstrtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfc
    iavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesga
    gktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnns
    srfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvm
    lvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmge
    mkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvv
    nsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinyt
    nerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfp
    kaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkd
    pinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknl
    ysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqry
    silapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlsk
    iismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkpllsia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5gA (A:)
    idfsdpdfqylavdrkklmkfdgkkncwvpdekegfasaeiqsskgdeitvkivadsstr
    tvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavnpyr
    rlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagktentk
    kvimylakvacavegsledqiiqanpvleaygnakttrnnnssrfgkfirihfgptgkia
    gadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtpdsglysfinqgclt
    vdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfkqrpreeqaesdgta
    eaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvvnsvgalakslydrmfnwl
    vrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerlqqffnhhmfileqe
    eykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkaddksfqdklyqnhmgk
    nrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkdpinenvvallgaskeplv
    aelfkapeqtisavhreslnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcn
    gvlegiricrkgfpsrliysefkqrysilapnaipqgfvdgktvsekilaglqmdpaeyr
    lgttkvffkagvlgnleemrderlskiismfqahirgylirkaykklqdqriglsviqrn
    irkwlvlrnwqwwklyskvkpl
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1s5gY (Y:)
    adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml
    keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf
    nkdemrmtfkeapveggkfdyvkftamikgsgeeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5gY (Y:)
    pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
    lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
    pveggkfdyvkftamikgsgee
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1s5gZ (Z:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5gZ (Z:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpypd