PDB entry 1s5f

View 1s5f on RCSB PDB site
Description: Cholera holotoxin, Crystal form 2
Deposited on 2004-01-20, released 2004-04-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1s5fa_
  • Chain 'D':
    Domains in SCOP 1.69: d1s5fd_
  • Chain 'E':
    Domains in SCOP 1.69: d1s5fe_
  • Chain 'F':
    Domains in SCOP 1.69: d1s5ff_
  • Chain 'G':
    Domains in SCOP 1.69: d1s5fg_
  • Chain 'H':
    Domains in SCOP 1.69: d1s5fh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s5fA (A:)
    nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
    stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggip
    ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
    hhappgcgnaprssmsntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5fA (A:)
    nddklyradsrppdeikqsgglmprgqseyfdqmninlydhargtqtgfvrhddgyvsts
    islrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggipysq
    iygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwihha
    ppgcgntcdektqslgvkfldeyqskvkrqifsgyqsdidthnr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5fD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5fE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5fF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s5fG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5fG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisma
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5fH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman