PDB entry 1s5b

View 1s5b on RCSB PDB site
Description: Cholera holotoxin with an A-subunit Y30S mutation Form 3
Deposited on 2004-01-20, released 2004-04-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.18
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1s5ba_
  • Chain 'D':
    Domains in SCOP 1.69: d1s5bd_
  • Chain 'E':
    Domains in SCOP 1.69: d1s5be_
  • Chain 'F':
    Domains in SCOP 1.69: d1s5bf_
  • Chain 'G':
    Domains in SCOP 1.69: d1s5bg_
  • Chain 'H':
    Domains in SCOP 1.69: d1s5bh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s5bA (A:)
    nddklyradsrppdeikqsgglmprgqsesfdrgtqmninlydhargtqtgfvrhddgyv
    stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggip
    ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
    hhappgcgnaprssmsntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5bA (A:)
    nddklyradsrppdeikqsgglmprmninlydharvrhddgyvstsislrsahlvgqtil
    sghstyyiyviatapnmfnvndvlgaysphpdeqevsalggipysqiygwyrvhfgvldq
    lhrnrgyrdryysnldiapaadgyglagfppehrawreepwihhappgcgtcdektqslg
    vkfldeyqskvkrqifsgyqsdidthnr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5bD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5bE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5bF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5bG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s5bH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman