PDB entry 1s5a

View 1s5a on RCSB PDB site
Description: Crystal Structure of Putative Isomerase from Bacillus subtilis
Class: Structural Genomics, Unknown function
Keywords: Structural Genomics, Hypothetical Protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Unknown function
Deposited on 2004-01-20, released 2004-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yesE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YESE, BSU06870
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31511
      • modified residue (5)
      • modified residue (19)
      • modified residue (22)
      • modified residue (27)
    Domains in SCOPe 2.07: d1s5aa_
  • Chain 'B':
    Compound: Hypothetical protein yesE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YESE, BSU06870
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31511 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (5)
      • modified residue (19)
      • modified residue (22)
      • modified residue (27)
    Domains in SCOPe 2.07: d1s5ab1, d1s5ab2
  • Chain 'C':
    Compound: Hypothetical protein yesE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YESE, BSU06870
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31511 (3-End)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (5)
      • modified residue (19)
      • modified residue (22)
      • modified residue (27)
    Domains in SCOPe 2.07: d1s5ac1, d1s5ac2
  • Chain 'D':
    Compound: Hypothetical protein yesE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YESE, BSU06870
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31511 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (5)
      • modified residue (19)
      • modified residue (22)
      • modified residue (27)
    Domains in SCOPe 2.07: d1s5ad1, d1s5ad2
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s5aA (A:)
    snamlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaai
    ydyikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdg
    rivryrdywnplvvkeafggsflqteesgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5aA (A:)
    mnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaaiydyik
    dypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdgrivry
    rdywnplvvkeafggsflq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s5aB (B:)
    snamlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaai
    ydyikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdg
    rivryrdywnplvvkeafggsflqteesgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5aB (B:)
    snamlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaai
    ydyikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdg
    rivryrdywnplvvkeafggsfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s5aC (C:)
    snamlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaai
    ydyikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdg
    rivryrdywnplvvkeafggsflqteesgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5aC (C:)
    amlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaaiyd
    yikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdgri
    vryrdywnplvvkeafggsflqt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s5aD (D:)
    snamlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaai
    ydyikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdg
    rivryrdywnplvvkeafggsflqteesgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s5aD (D:)
    snamlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaai
    ydyikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdg
    rivryrdywnplvvkeafg