PDB entry 1s59

View 1s59 on RCSB PDB site
Description: Structure of nucleoside diphosphate kinase 2 with bound dGTP from Arabidopsis
Class: transferase
Keywords: transferase, kinase
Deposited on 2004-01-20, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.207
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s59a_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s59b_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s59c_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s59d_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s59e_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s59f_
  • Heterogens: DGI, DGT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s59A (A:)
    smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
    ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
    sdspengkreiglwfkegelckwdsalatwlre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s59B (B:)
    smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
    ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
    sdspengkreiglwfkegelckwdsalatwlre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s59B (B:)
    veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn
    lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp
    engkreiglwfkegelckwdsalatwlre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s59C (C:)
    smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
    ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
    sdspengkreiglwfkegelckwdsalatwlre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s59C (C:)
    veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn
    lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp
    engkreiglwfkegelckwdsalatwlre
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s59D (D:)
    smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
    ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
    sdspengkreiglwfkegelckwdsalatwlre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s59E (E:)
    smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
    ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
    sdspengkreiglwfkegelckwdsalatwlre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s59E (E:)
    veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn
    lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp
    engkreiglwfkegelckwdsalatwlre
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s59F (F:)
    smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
    ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
    sdspengkreiglwfkegelckwdsalatwlre