PDB entry 1s58

View 1s58 on RCSB PDB site
Description: The structure of B19 parvovirus capsid
Class: Virus
Keywords: icosahedral capsid, beta-barrel, Icosahedral virus
Deposited on 2004-01-20, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.313
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B19 parvovirus capsid
    Species: Human parvovirus B19 [TaxId:10798]
    Gene: VP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s58a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s58A (A:)
    mtsvnsaeastgagggssnpvksmwsegatfsansvtctfsrqflipydpehhykvfspa
    asschnasgkeakvctitpimgystpwryldfnalnlffsplefqhlienygsiapdalt
    vtiseiavkdvtdktgggvqvtdsatgrlcmlvdheykypyvlgqgqdtlapelpiwvyf
    ppqyayltvgdvntqgisgdskklaseesafyvlehssfqllgtggtatmsykfppvppe
    nlegcsqhfyemynplygsrlgvpdtlggdpkfrslthedhaiqpqnfmpgplvnsvstk
    egdssntgagkaltglstgtsqntrislrpgpvsqpyhhwdtdkyvtginaishgqttyg
    naedkeyqqgvgrfpnekeqlkqlqglnmhtyfpnkgtqqytdqierplmvgsvwnrral
    hyesqlwskipnlddsfktqfaalggwglhqpppqiflkilpqsgpiggiksmgittlvq
    yavgimtvtmtfklgprkatgrwnpqpgvypphaaghlpyvlydptatdakqhhrhgyek
    peelwtaksrvhpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s58A (A:)
    npvksmwsegatfsansvtctfsrqflipydpehhykvfspaasschnasgkeakvctit
    pimgystpwryldfnalnlffsplefqhlienygsiapdaltvtiseiavkdvtdktggg
    vqvtdsatgrlcmlvdheykypyvlgqgqdtlapelpiwvyfppqyayltvgdvntqgis
    gdskklaseesafyvlehssfqllgtggtatmsykfppvppenlegcsqhfyemynplyg
    srlgvpdtlggdpkfrslthedhaiqpqnfmpgplvnsvstktglstgtsqntrislrpg
    pvsqpyhhwdtdkyvtginaishgqttygnaedkeyqqgvgrfpnekeqlkqlqglnmht
    yfpnkgtqqytdqierplmvgsvwnrralhyesqlwskipnlddsfktqfaalggwglhq
    pppqiflkilpqsgpiggiksmgittlvqyavgimtvtmtfklgprkatgrwnpqpgvyp
    phaaghlpyvlydptatdakqhhrhgyekpeelwtaksrvhpl