PDB entry 1s57

View 1s57 on RCSB PDB site
Description: crystal structure of nucleoside diphosphate kinase 2 from Arabidopsis
Class: transferase
Keywords: transferase, kinase
Deposited on 2004-01-20, released 2004-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s57a_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s57b_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s57c_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s57d_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s57e_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NDPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s57f_
  • Heterogens: SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s57A (A:)
    smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
    ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
    sdspengkreiglwfkegelckwdsalatwlre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s57B (B:)
    smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
    ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
    sdspengkreiglwfkegelckwdsalatwlre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s57B (B:)
    veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn
    lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp
    engkreiglwfkegelckwdsalatwlre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s57C (C:)
    smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
    ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
    sdspengkreiglwfkegelckwdsalatwlre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s57C (C:)
    veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn
    lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp
    engkreiglwfkegelckwdsalatwlre
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s57D (D:)
    smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
    ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
    sdspengkreiglwfkegelckwdsalatwlre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s57E (E:)
    smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
    ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
    sdspengkreiglwfkegelckwdsalatwlre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s57E (E:)
    veetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaksffpn
    lieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhgsdsp
    engkreiglwfkegelckwdsalatwlre
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s57F (F:)
    smedveetyimvkpdgiqrglvgeiisrfekkgfkliglkmfqcpkelaeehykdlsaks
    ffpnlieyitsgpvvcmawegvgvvasarkligktdplqaepgtirgdlavqtgrnivhg
    sdspengkreiglwfkegelckwdsalatwlre