PDB entry 1s55

View 1s55 on RCSB PDB site
Description: Mouse RANKL Structure at 1.9A Resolution
Class: cytokine
Keywords: cytokine
Deposited on 2004-01-19, released 2005-07-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.23
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor ligand superfamily member 11
    Species: Mus musculus [TaxId:10090]
    Gene: TNFSF11, RANKL, TRANCE, OPGL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s55a_
  • Chain 'B':
    Compound: tumor necrosis factor ligand superfamily member 11
    Species: Mus musculus [TaxId:10090]
    Gene: TNFSF11, RANKL, TRANCE, OPGL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s55b_
  • Chain 'C':
    Compound: tumor necrosis factor ligand superfamily member 11
    Species: Mus musculus [TaxId:10090]
    Gene: TNFSF11, RANKL, TRANCE, OPGL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s55c_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s55A (A:)
    aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
    frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
    klrageeisiqvsnpslldpdqdatyfgafkvqdid
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s55B (B:)
    aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
    frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
    klrageeisiqvsnpslldpdqdatyfgafkvqdid
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s55C (C:)
    aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
    frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
    klrageeisiqvsnpslldpdqdatyfgafkvqdid