PDB entry 1s4u

View 1s4u on RCSB PDB site
Description: Crystal Structure analysis of the beta-propeller protein Ski8p
Class: antiviral protein
Keywords: WD repeat, ANTIVIRAL PROTEIN
Deposited on 2004-01-18, released 2004-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.253
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Antiviral protein SKI8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SKI8, YGL213C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s4ux_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1s4uX (X:)
    gplgspefpgmskvfiatanagkahdadifsvsacnsftvscsgdgylkvwdnklldnen
    pkdksyshfvhksglhhvdvlqaierdafelclvattsfsgdllfyritredetkkvife
    kldlldsdmkkhsfwalkwgasndrllshrlvatdvkgttyiwkfhpfadesnsltlnws
    ptlelqgtvespmtpsqfatsvdisergliatgfnngtvqiselstlrplynfesqhsmi
    nnsnsirsvkfspqgsllaiahdsnsfgcitlyetefgerigslsvpthssqaslgefah
    sswvmslsfndsgetlcsagwdgklrfwdvktkerittlnmhcddieieedilavdehgd
    slaepgvfdvkflkkgwrsgmgadlneslccvcldrsirwfreaggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4uX (X:)
    kvfiatanagkahdadifsvsacnsftvscsgdgylkvwdnklldnenpkdksyshfvhk
    sglhhvdvlqaierdafelclvattsfsgdllfyritrkkvifekldlldsdmkkhsfwa
    lkwgaslshrlvatdvkgttyiwkfhpfadesnsltlnwsptlelqgtvespmtpsqfat
    svdisergliatgfnngtvqiselstlrplynfensirsvkfspqgsllaiahdsnsfgc
    itlyetefgerigslsvfahsswvmslsfndsgetlcsagwdgklrfwdvktkerittln
    mhcddieieedilavdehgdslaepgvfdvkflkkgwrsneslccvcldrsirwfr