PDB entry 1s4q

View 1s4q on RCSB PDB site
Description: Crystal Structure of Guanylate Kinase from Mycobacterium tuberculosis (Rv1389)
Class: transferase
Keywords: TRANSFERASE, ATP:GMP-phosphotransferase, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2004-01-16, released 2004-01-27
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: MYCOBACTERIUM TUBERCULOSIS
    Gene: GMK, RV1389, MT1434, MTCY21B4.06, MB1424
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s4qa_
  • Heterogens: CL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s4qA (A:)
    mavsvgegpdtkptargqpaavgrvvvlsgpsavgkstvvrclreripnlhfsvsattra
    prpgevdgvdyhfidptrfqqlidqgellewaeihgglhrsgtlaqpvraaaatgvpvli
    evdlagaraikktmpeavtvflappswqdlqarligrgtetadviqrrldtarielaaqg
    dfdkvvvnrrlesacaelvsllvgtapgspgvprgklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4qA (A:)
    vgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprpgevdgvdyhfidptrfqq
    lidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtvf
    lappswqdlqarligrgtetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvsl
    lvg