PDB entry 1s4n

View 1s4n on RCSB PDB site
Description: crystal structure of yeast alpha1,2-mannosyltransferase kre2p/mnt1p
Deposited on 2004-01-16, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.18
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1s4na_
  • Chain 'B':
    Domains in SCOP 1.67: d1s4nb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s4nA (A:)
    efadapidtkttmdyitpsfankagkpkacyvtlvrnkelkgllssikyvenkinkkfpy
    pwvflndepfteefkeavtkavssevkfgilpkehwsypewinqtkaaeiradaatkyiy
    ggsesyrhmcryqsgffwrhelleeydwywrvepdiklycdinydvfkwmqenekvygft
    vsiheyevtiptlwqtsmdfikknpeyldennlmsflsndngktynlchfwsnfeianln
    lwrspayreyfdtldhqggffyerwgdapvhsiaaalflpkdkihyfsdigyhhppydnc
    pldkevynsnncecdqgndftfqgyscgkeyydaqglvkpknwkkfre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4nA (A:)
    kttmdyitpsfkagkpkacyvtlvrnkelkgllssikyvenkinkkfpypwvflndepft
    eefkeavtkavssevkfgilpkehwsypewinqtkaaeiradaatkyiyggsesyrhmcr
    yqsgffwrhelleeydwywrvepdiklycdinydvfkwmqenekvygftvsiheyevtip
    tlwqtsmdfikknpeyldennlmsflsndngktynlchfwsnfeianlnlwrspayreyf
    dtldhqggffyerwgdapvhsiaaalflpkdkihyfsdigyhhppydncpldkevynsnn
    cecdqgndftfqgyscgkeyydaqglvkpknwkkfre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s4nB (B:)
    efadapidtkttmdyitpsfankagkpkacyvtlvrnkelkgllssikyvenkinkkfpy
    pwvflndepfteefkeavtkavssevkfgilpkehwsypewinqtkaaeiradaatkyiy
    ggsesyrhmcryqsgffwrhelleeydwywrvepdiklycdinydvfkwmqenekvygft
    vsiheyevtiptlwqtsmdfikknpeyldennlmsflsndngktynlchfwsnfeianln
    lwrspayreyfdtldhqggffyerwgdapvhsiaaalflpkdkihyfsdigyhhppydnc
    pldkevynsnncecdqgndftfqgyscgkeyydaqglvkpknwkkfre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4nB (B:)
    tkttmdyitpsfkpkacyvtlvrnkelkgllssikyvenkinkkfpypwvflndepftee
    fkeavtkavssevkfgilpkehwsypewinqtkaaeiradaatkyiyggsesyrhmcryq
    sgffwrhelleeydwywrvepdiklycdinydvfkwmqenekvygftvsiheyevtiptl
    wqtsmdfikknpeyldennlmsflsndngktynlchfwsnfeianlnlwrspayreyfdt
    ldhqggffyerwgdapvhsiaaalflpkdkihyfsdigyhhppydncpldkevynsnnce
    cdqgndftfqgyscgkeyydaqglvkpknwkkfre