PDB entry 1s4m

View 1s4m on RCSB PDB site
Description: Crystal structure of flavin binding to FAD synthetase from Thermotoga maritina
Class: transferase
Keywords: FAD, flavin, riboflavin kinase, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, TRANSFERASE
Deposited on 2004-01-16, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin kinase/FMN adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4ma1, d1s4ma2
  • Chain 'B':
    Compound: Riboflavin kinase/FMN adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4mb1, d1s4mb2
  • Heterogens: MG, LUM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s4mA (A:)
    mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
    emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
    evyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhkdrefgrklgfpt
    anidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrptvgdarnvkyevyildfegd
    lygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskfekeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4mA (A:)
    mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
    emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
    evyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhkfptanidrgnek
    lvdlkrgvylvrvhlpdgkkkfgvmnvgfrptdarnvkyevyildfegdlygqrlklevl
    kfmrdekkfdsieelkaaidqdvksarnmiddiinsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s4mB (B:)
    mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
    emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
    evyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhkdrefgrklgfpt
    anidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrptvgdarnvkyevyildfegd
    lygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskfekeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4mB (B:)
    mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
    emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
    evyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhkfptanidrgnek
    lvdlkrgvylvrvhlpdgkkkfgvmnvgfnvkyevyildfegdlygqrlklevlkfmrde
    kkfdsieelkaaidqdvksarnmiddiinskf