PDB entry 1s4k

View 1s4k on RCSB PDB site
Description: Putative cytoplasmic protein from Salmonella typhimurium
Deposited on 2004-01-16, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1s4ka_
  • Chain 'B':
    Domains in SCOP 1.69: d1s4kb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s4kA (A:)
ammnalelqalrrifdmtieectiyitqdnnsatwqrweagdipispeiiarlkemkarr
qrrinaivdkinnrignntmryfpdlssfqsiytegdfiewkiyqsvaaelfahdlerlc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s4kB (B:)
ammnalelqalrrifdmtieectiyitqdnnsatwqrweagdipispeiiarlkemkarr
qrrinaivdkinnrignntmryfpdlssfqsiytegdfiewkiyqsvaaelfahdlerlc