PDB entry 1s4k

View 1s4k on RCSB PDB site
Description: Putative cytoplasmic protein from Salmonella typhimurium
Class: structural genomics, unknown function
Keywords: structural genomics, MCSG, Salmonella typhimurium, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, unknown function
Deposited on 2004-01-16, released 2004-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytoplasmic protein ydil
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ydiL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZPR1 (1-119)
      • cloning artifact (0)
      • modified residue (1-2)
      • modified residue (16)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.08: d1s4ka1, d1s4ka2
  • Chain 'B':
    Compound: putative cytoplasmic protein ydil
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ydiL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZPR1 (1-119)
      • cloning artifact (0)
      • modified residue (1-2)
      • modified residue (16)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.08: d1s4kb1, d1s4kb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s4kA (A:)
    ammnalelqalrrifdmtieectiyitqdnnsatwqrweagdipispeiiarlkemkarr
    qrrinaivdkinnrignntmryfpdlssfqsiytegdfiewkiyqsvaaelfahdlerlc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s4kB (B:)
    ammnalelqalrrifdmtieectiyitqdnnsatwqrweagdipispeiiarlkemkarr
    qrrinaivdkinnrignntmryfpdlssfqsiytegdfiewkiyqsvaaelfahdlerlc