PDB entry 1s4f

View 1s4f on RCSB PDB site
Description: Crystal Structure of RNA-dependent RNA polymerase construct 2 from bovine viral diarrhea virus (BVDV)
Class: replication, RNA binding protein
Keywords: Polymerase, RNA synthesis, primer independent initiation, de novo initiation, bovine viral diarrhea virus, BVDV, REPLICATION, RNA BINDING PROTEIN
Deposited on 2004-01-16, released 2004-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.254
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-dependent RNA polymerase
    Species: Bovine viral diarrhea virus 1 [TaxId:11099]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4fa_
  • Chain 'B':
    Compound: RNA-dependent RNA polymerase
    Species: Bovine viral diarrhea virus 1 [TaxId:11099]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4fb_
  • Chain 'C':
    Compound: RNA-dependent RNA polymerase
    Species: Bovine viral diarrhea virus 1 [TaxId:11099]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4fc_
  • Chain 'D':
    Compound: RNA-dependent RNA polymerase
    Species: Bovine viral diarrhea virus 1 [TaxId:11099]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4fd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s4fA (A:)
    ieeeekkprvkdtvirehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhq
    igtimssagirleklpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqp
    tlkhtygevtweqleagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyye
    taipknekrdvsddwqagdlvvekrprviqypeaktrlaitkvmynwvkqqpvvipgyeg
    ktplfnifdkvrkewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfid
    titdhmtevpvitadgevyirngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfn
    rvarihvcgddgflitekglglkfankgmqilheagkpqkitegekmkvayrfediefcs
    htpvpvrwsdntsshmagrdtavilskmatrldssgergttayekavafsfllmyswnpl
    vrricllvlsqqpetdpskhatyyykgdpigaykdvigrnlselkrtgfeklanlnlsls
    tlgvwtkhtskriiqdcvaigkeegnwlvkpdrlissktghlyipdkgftlqgkhyeqlq
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4fA (A:)
    virehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhqigtimssagirle
    klpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqptlkhtygevtweq
    leagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyyetaipknekrdvsd
    dwqagdlvvekrprviqypeaktrlaitkvmynwvkqqpvvipgyegktplfnifdkvrk
    ewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfidtitdhmtevpvit
    adgevyirngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfnrvarihvcgddgf
    litekglglkfankgmqilheagkpqkitegekmkvayrfediefcshtpvpvrwsdnts
    shmagrdtavilskmatrldssgergttayekavafsfllmyswnplvrricllvlsqqp
    etdpskhatyyykgdpigaykdvigrnlselkrtgfeklanlnlslstlgvwtkhtskri
    iqdcvaigkeegnwlvkpdrlissktghlyipdkgftlqgkhy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s4fB (B:)
    ieeeekkprvkdtvirehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhq
    igtimssagirleklpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqp
    tlkhtygevtweqleagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyye
    taipknekrdvsddwqagdlvvekrprviqypeaktrlaitkvmynwvkqqpvvipgyeg
    ktplfnifdkvrkewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfid
    titdhmtevpvitadgevyirngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfn
    rvarihvcgddgflitekglglkfankgmqilheagkpqkitegekmkvayrfediefcs
    htpvpvrwsdntsshmagrdtavilskmatrldssgergttayekavafsfllmyswnpl
    vrricllvlsqqpetdpskhatyyykgdpigaykdvigrnlselkrtgfeklanlnlsls
    tlgvwtkhtskriiqdcvaigkeegnwlvkpdrlissktghlyipdkgftlqgkhyeqlq
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4fB (B:)
    virehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhqigtimssagirle
    klpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqptlkhtygevtweq
    leagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyyetaipknekrdvsd
    dwqagdlvvekrprviqypeaktrlaitkvmynwvkqqpvvipgyegktplfnifdkvrk
    ewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfidtitdhmtevpvit
    adgevyirngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfnrvarihvcgddgf
    litekglglkfankgmqilheagkpqkitegekmkvayrfediefcshtpvpvrwsdnts
    shmagrdtavilskmatrldssgergttayekavafsfllmyswnplvrricllvlsqqp
    etdpskhatyyykgdpigaykdvigrnlselkrtgfeklanlnlslstlgvwtkhtskri
    iqdcvaigkeegnwlvkpdrlissktghlyipdkgftlqgkhy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s4fC (C:)
    ieeeekkprvkdtvirehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhq
    igtimssagirleklpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqp
    tlkhtygevtweqleagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyye
    taipknekrdvsddwqagdlvvekrprviqypeaktrlaitkvmynwvkqqpvvipgyeg
    ktplfnifdkvrkewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfid
    titdhmtevpvitadgevyirngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfn
    rvarihvcgddgflitekglglkfankgmqilheagkpqkitegekmkvayrfediefcs
    htpvpvrwsdntsshmagrdtavilskmatrldssgergttayekavafsfllmyswnpl
    vrricllvlsqqpetdpskhatyyykgdpigaykdvigrnlselkrtgfeklanlnlsls
    tlgvwtkhtskriiqdcvaigkeegnwlvkpdrlissktghlyipdkgftlqgkhyeqlq
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4fC (C:)
    virehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhqigtimssagirle
    klpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqptlkhtygevtweq
    leagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyyetaipknekrdvsd
    dwqagdlvvekrprviqypeaktrlaitkvmynwvkqqpvvipgyegktplfnifdkvrk
    ewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfidtitdhmtevpvit
    adgevyirngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfnrvarihvcgddgf
    litekglglkfankgmqilheagkpqkitegekmkvayrfediefcshtpvpvrwsdnts
    shmagrdtavilskmatrldssrgttayekavafsfllmyswnplvrricllvlsqqpet
    dpskhatyyykgdpigaykdvigrnlselkrtgfeklanlnlslstlgvwtkhtskriiq
    dcvaigkeegnwlvkpdrlissktghlyipdkgftlqgkhy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s4fD (D:)
    ieeeekkprvkdtvirehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhq
    igtimssagirleklpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqp
    tlkhtygevtweqleagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyye
    taipknekrdvsddwqagdlvvekrprviqypeaktrlaitkvmynwvkqqpvvipgyeg
    ktplfnifdkvrkewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfid
    titdhmtevpvitadgevyirngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfn
    rvarihvcgddgflitekglglkfankgmqilheagkpqkitegekmkvayrfediefcs
    htpvpvrwsdntsshmagrdtavilskmatrldssgergttayekavafsfllmyswnpl
    vrricllvlsqqpetdpskhatyyykgdpigaykdvigrnlselkrtgfeklanlnlsls
    tlgvwtkhtskriiqdcvaigkeegnwlvkpdrlissktghlyipdkgftlqgkhyeqlq
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4fD (D:)
    virehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhqigtimssagirle
    klpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqptlkhtygevtweq
    leagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyyetaipknekrdvsd
    dwqagrprviqypeaktrlaitkvmynwvkqqpvvipgyegktplfnifdkvrkewdsfn
    epvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfidtitdhmtevpvitadgevy
    irngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfnrvarihvcgddgflitekg
    lglkfankgmqilheagkpqkitegekmkvayrfediefcshtpvpvrwsdntsshmagr
    dtavilskmatrsgergttayekavafsfllmyswnplvrricllvlsqqpetdpskhat
    yyykgdpigaykdvigrnlselkrtgfeklanlnlslstlgvwtkhtskriiqdcvaigk
    eegnwlvkpdrlissktghlyipdkgftlqgkhye