PDB entry 1s4e

View 1s4e on RCSB PDB site
Description: pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium
Deposited on 2004-01-16, released 2004-04-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.232
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s4eA (A:)
    mskitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftl
    dnltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnq
    lynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk
    dvsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsy
    ivrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgayga
    rltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4eA (A:)
    tvkspgrvnligehtdytygyvmpmaidlytiitdkvqlysehfnekldltkegswidyv
    kgvlwvliqegykigglkkitgdlplgaglsssasfevgilevlnqlynlnidplkkall
    akkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpkdvsvlvfytgvkre
    lasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsyivrenarvlevrda
    lkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgaygarltgagfggsaial
    vdkdkaktigdailreylakfswkakyfvvkpsdgvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s4eB (B:)
    mskitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftl
    dnltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnq
    lynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk
    dvsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsy
    ivrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgayga
    rltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4eB (B:)
    spgrvnligehtdytygyvmpmaidlytkydkvqlvkgvlwvliqegykigglkgitgdl
    plgaglsssasfevgilevlnqlynlnidplkkallakkaenevgvpcgildqfavvfgk
    kdnvifldtqtlqyeyipfpkdvsvlvfytgvkrelasseyaerkriaeeslrilgkess
    kevtekdlgklpplhrkffsyivrenarvlevrdalkegdiekvgkilttahwdlaenyr
    vsceeldffvkkamelgaygarltgagfggsaialvdkdkaktigdailreylakfswka
    kyfvvkpsdg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s4eC (C:)
    mskitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftl
    dnltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnq
    lynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk
    dvsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsy
    ivrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgayga
    rltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4eC (C:)
    itvkspgrvnligehtdytygyvmpmaidlytiitaekkvqlysehfnektftldnlkeg
    swidyvkgvlwvliqegyigglkgkitgdlplgaglsssasfevgilevlnqlynlnidp
    lkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpkdvsvlvfy
    tgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsyivrenarv
    levrdalkediekvgkilttahwdlaenyrvsceldffvkkamelaygarltgagfggsa
    ialvdkdkaktigdalrelakfswkakyfvvkpsdgv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s4eD (D:)
    mskitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftl
    dnltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnq
    lynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk
    dvsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsy
    ivrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgayga
    rltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4eD (D:)
    skitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftld
    tkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnqlyn
    lnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpkdvs
    vlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsyivr
    enarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgaygarlt
    gagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s4eE (E:)
    mskitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftl
    dnltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnq
    lynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk
    dvsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsy
    ivrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgayga
    rltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4eE (E:)
    kitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftldn
    ltkgswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnqlyn
    lnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpkdvs
    vlvfytgvkelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsyivre
    narvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgaygarltg
    agfggsaialvdkdkaktigdailylakfswkakyfvvkpsdgvgv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s4eF (F:)
    mskitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftl
    dnltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnq
    lynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk
    dvsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsy
    ivrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgayga
    rltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4eF (F:)
    skitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftld
    nltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnql
    ynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpkd
    vsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsyi
    vrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgaygar
    ltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s4eG (G:)
    mskitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftl
    dnltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnq
    lynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk
    dvsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsy
    ivrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgayga
    rltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4eG (G:)
    rvnligehtdytygyvmpmaidlywidygvlwvliqegydlpsssasevgiledplkkal
    lakkaenefvcgildqfavvfgnvifldtqtlqyeyipfpvlvfytgvkasseyaerkri
    aeeslrilgkesskevtekdlgklpplhrkffsyivrenarvlevrdalegdiekvgkil
    ttahwdlaenyrvsceeldffvkkamelgaygarltgagfggsaidkdaktigdailrey
    lakfswkakfvvkps
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s4eH (H:)
    mskitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftl
    dnltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnq
    lynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk
    dvsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsy
    ivrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgayga
    rltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4eH (H:)
    skitvkspgrvnligehtdytygyvmpmaidlytiitaekykvqlysehfneektftldn
    lkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnqlyn
    lnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpkdvs
    vlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsyivr
    enarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgaygarlt
    gagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1s4eI (I:)
    mskitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftl
    dnltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnq
    lynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk
    dvsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsy
    ivrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgayga
    rltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4eI (I:)
    skitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftld
    nltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnql
    ynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpkd
    vsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsyi
    vrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgaygar
    ltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdgvgv