PDB entry 1s4d

View 1s4d on RCSB PDB site
Description: Crystal Structure Analysis of the S-adenosyl-L-methionine dependent uroporphyrinogen-III C-methyltransferase SUMT
Class: Transferase
Keywords: tetrapyrrole biosynthesis, cobalamin, SAM, SAH, uroporphyrinogen-III methyltransferase, Transferase
Deposited on 2004-01-16, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.215
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4da_
  • Chain 'B':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4db_
  • Chain 'D':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4dd_
  • Chain 'E':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4de_
  • Chain 'F':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4df_
  • Chain 'G':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4dg_
  • Chain 'H':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4dh_
  • Chain 'I':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4di_
  • Chain 'J':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4dj_
  • Chain 'K':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4dk_
  • Chain 'L':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4dl_
  • Chain 'M':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s4dm_
  • Heterogens: SAH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s4dA (A:)
    middlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarp
    gavlefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehq
    vpfrivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvi
    vmymamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaaglepp
    aivvvgevvrlraaldwigaldgrklaadpfanrilrnpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4dA (A:)
    faglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavle
    fagkrgpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfrivp
    gitagigglayagipvthrevnhavtfltghdrinwqgiasgspvivmymamkhigaita
    nliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvgevvrlraa
    ldwigaldgrklaadp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s4dB (B:)
    middlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarp
    gavlefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehq
    vpfrivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvi
    vmymamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaaglepp
    aivvvgevvrlraaldwigaldgrklaadpfanrilrnpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4dB (B:)
    dlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgav
    lefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpf
    rivpgitagigglayagipvthrevnhavtfltghdssgvpdrinwqgiasgspvivmym
    amkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivv
    vgevvrlraaldwigaldgrkla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s4dD (D:)
    middlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarp
    gavlefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehq
    vpfrivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvi
    vmymamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaaglepp
    aivvvgevvrlraaldwigaldgrklaadpfanrilrnpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4dD (D:)
    aglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavlef
    agpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfrivpgita
    gigglayagipvthrevnhavtfltghdssgrinwqgiasgspvivmymamkhigaitan
    liaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvgevvrlraal
    dwigaldg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s4dE (E:)
    middlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarp
    gavlefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehq
    vpfrivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvi
    vmymamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaaglepp
    aivvvgevvrlraaldwigaldgrklaadpfanrilrnpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4dE (E:)
    dlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgav
    lefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpf
    rivpgitagigglayagipvthrevnhavtfltghdssgpdrinwqgiasgspvivmyma
    mkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvv
    gevvrlraaldwigaldgrklaadp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s4dF (F:)
    middlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarp
    gavlefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehq
    vpfrivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvi
    vmymamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaaglepp
    aivvvgevvrlraaldwigaldgrklaadpfanrilrnpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4dF (F:)
    aglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavlef
    agkkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfrivpgi
    tagigglayagipvthrevnhavtfltghvpdrinwqgiasgspvivmymamkhigaita
    nliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvgevvrlraa
    ldwigadgrklaad
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s4dG (G:)
    middlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarp
    gavlefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehq
    vpfrivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvi
    vmymamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaaglepp
    aivvvgevvrlraaldwigaldgrklaadpfanrilrnpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4dG (G:)
    glpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavlefa
    gkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfrivp
    gitagigglayagipvthrevnhavtfltghdssgpdrinwqgiasgspvivmymamkhi
    gaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvgevv
    rlraaldwigaldgrkla
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s4dH (H:)
    middlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarp
    gavlefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehq
    vpfrivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvi
    vmymamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaaglepp
    aivvvgevvrlraaldwigaldgrklaadpfanrilrnpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4dH (H:)
    faglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavle
    fagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfri
    vpgitagigglayagipvthrevnhavtfltghdrinwqgiasgspvivmymamkhigai
    tanliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvgevvrlr
    aaldwigaldgrklaadpf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1s4dI (I:)
    middlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarp
    gavlefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehq
    vpfrivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvi
    vmymamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaaglepp
    aivvvgevvrlraaldwigaldgrklaadpfanrilrnpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4dI (I:)
    dlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgav
    lefagkrggpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfr
    ivpgitagigglayagipvthrevnhavtfltghdssvpdrinwqgiasgspvivmymam
    khigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvg
    evvrlraaldwigaldgrklaad
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1s4dJ (J:)
    middlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarp
    gavlefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehq
    vpfrivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvi
    vmymamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaaglepp
    aivvvgevvrlraaldwigaldgrklaadpfanrilrnpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4dJ (J:)
    faglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavle
    fagkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfrivpgi
    tagigglayagipvthrevnhavtfltghdrinwqgiasgspvivmymamkhigaitanl
    iaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvgevvrlraald
    wigaldgrklaa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1s4dK (K:)
    middlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarp
    gavlefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehq
    vpfrivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvi
    vmymamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaaglepp
    aivvvgevvrlraaldwigaldgrklaadpfanrilrnpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4dK (K:)
    lfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavl
    efagkrggpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfri
    vpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvivmyma
    mkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvv
    gevvrlraaldwigaldg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1s4dL (L:)
    middlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarp
    gavlefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehq
    vpfrivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvi
    vmymamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaaglepp
    aivvvgevvrlraaldwigaldgrklaadpfanrilrnpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4dL (L:)
    aglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavlef
    agkggkpskqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfrivpg
    itagigglayagipvthrevnhavtfltghvpdrinwqgiasgspvivmymamkhigait
    anliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvgevvrlra
    aldwiga
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1s4dM (M:)
    middlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarp
    gavlefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehq
    vpfrivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvi
    vmymamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaaglepp
    aivvvgevvrlraaldwigaldgrklaadpfanrilrnpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4dM (M:)
    palekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavlefagk
    rggpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfrivpgit
    agigglayagipvthrevnhavtfltghdrinwqgiasgspvivmymamkhigaitanli
    aggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvgevvrlraaldw
    igaldgrklaad