PDB entry 1s4c

View 1s4c on RCSB PDB site
Description: yhch protein (hi0227) copper complex
Class: structural genomics, unknown function
Keywords: Double-stranded beta-helix, STRUCTURAL GENOMICS, UNKNOWN FUNCTION, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2004-01-15, released 2005-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein HI0227
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s4ca_
  • Chain 'B':
    Compound: Protein HI0227
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s4cb_
  • Chain 'C':
    Compound: Protein HI0227
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s4cc_
  • Chain 'D':
    Compound: Protein HI0227
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s4cd_
  • Heterogens: CU, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s4cA (A:)
    miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk
    kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm
    favfypyephkpccvvngktekikklvvkvpvkli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4cA (A:)
    miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk
    kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm
    favfypyephkpccvekikklvvkvpvkli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s4cB (B:)
    miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk
    kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm
    favfypyephkpccvvngktekikklvvkvpvkli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s4cC (C:)
    miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk
    kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm
    favfypyephkpccvvngktekikklvvkvpvkli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4cC (C:)
    miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepkaelhhey
    ldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkmfavfypye
    phkpccvvngktekikklvvkvpvkli
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s4cD (D:)
    miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk
    kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm
    favfypyephkpccvvngktekikklvvkvpvkli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4cD (D:)
    miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepkaelhhey
    ldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkmfavfypye
    phkpccvikklvvkvpvkli