PDB entry 1s4b

View 1s4b on RCSB PDB site
Description: Crystal structure of human thimet oligopeptidase.
Class: hydrolase
Keywords: Zinc metallopeptidase domain
Deposited on 2004-01-15, released 2004-07-20
The last revision prior to the SCOP 1.73 freeze date was dated 2004-07-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: Thimet oligopeptidase
    Species: HOMO SAPIENS
    Gene: THOP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52888
      • engineered (230)
      • engineered (237)
    Domains in SCOP 1.73: d1s4bp_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1s4bP (P:)
    spcsvvndlrwdlsaqqieertrelieqtkrvydqvgtqefedvsyestlkaladvevty
    tvqrnildfpqhvspskdirtasteadkklsefdvemsmredvyqrivwlqekvqkdslr
    peaarylerliklgrrnglhlpretqenikrikkklsllcidfnknlnedttflpftlqe
    lgglpedflnslekmedgklkvtlkyphyfpllkkchvpetrrkveeafnsrckeensai
    lkelvtlraqksrllgfhthadyvlemnmaktsqtvatfldelaqklkplgeqeravile
    lkraecerrglpfdgrirawdmryymnqveetrycvdqnllkeyfpvqvvthgllgiyqe
    llglafhheegasawhedvrlytardaasgevvgkfyldlypregkyghaacfglqpgcl
    rqdgsrqiaiaamvanftkptadapsllqhdevetyfhefghvmhqlcsqaefamfsgth
    verdfveapsqmlenwvweqepllrmsrhyrtgsavprellekliesrqantglfnlrqi
    vlakvdqalhtqtdadpaeeyarlcqeilgvpatpgtnmpatfghlaggydaqyygylws
    evysmdmfhtrfkqegvlnskvgmdyrscilrpggsedasamlrrflgrdpkqdafllsk
    glqvggcepepqvc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s4bP (P:)
    lrwdlsaqqieertrelieqtkrvydqvgtqefedvsyestlkaladvevtytvqrnild
    fpqhvspskdirtasteadkklsefdvemsmredvyqrivwlqekvqkdslrpeaaryle
    rliklgrrnglhlpretqenikrikkklsllcidfnknlnedttflpftlqelgglpedf
    lnslekmedgklkvtlkyphyfpllkkchvpetrrkveeafnsrckeensailkelvtlr
    aqksrllgfhthadyvlemnmaktsqtvatfldelaqklkplgeqeravilelkraecer
    rglpfdgrirawdmryymnqveetrycvdqnllkeyfpvqvvthgllgiyqellglafhh
    eegasawhedvrlytardaasgevvgkfyldlypregkyghaacfglqpgclrqdgsrqi
    aiaamvanftkptadapsllqhdevetyfhefghvmhqlcsqaefamfsgthverdfvea
    psqmlenwvweqepllrmsrhyrtgsavprellekliesrqantglfnlrqivlakvdqa
    lhtqtdadpaeeyarlcqeilgvpatpgtnmpatfghlaggydaqyygylwsevysmdmf
    htrfkqegvlnskvgmdyrscilrpggsedasamlrrflgrdpkqdafllskgl