PDB entry 1s48

View 1s48 on RCSB PDB site
Description: Crystal structure of RNA-dependent RNA polymerase construct 1 (residues 71-679) from BVDV
Class: replication, RNA binding protein
Keywords: polymerase, primer independent initiation, de novo initiation, RNA virus, BVDV, bovine viral diarrhea virus, REPLICATION, RNA BINDING PROTEIN
Deposited on 2004-01-15, released 2004-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.229
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-dependent RNA polymerase
    Species: Bovine viral diarrhea virus 1 [TaxId:11099]
    Gene: NS5B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19711 (Start-608)
      • modified residue (44)
      • modified residue (72)
      • modified residue (231)
      • modified residue (313)
      • modified residue (345)
      • modified residue (351-352)
      • modified residue (396)
      • modified residue (414)
      • modified residue (443)
      • modified residue (455)
      • modified residue (481)
    Domains in SCOPe 2.07: d1s48a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s48A (A:)
    aylklkdfieeeekkprvkdtvirehnkwilkkirfqgnlntkkmlnpgklseqldregr
    krniynhqigtimssagirleklpivraqtdtktfheairdkidksenrqnpelhnklle
    ifhtiaqptlkhtygevtweqleagvnrkgaagflekknigevldsekhlveqlvrdlka
    grkikyyetaipknekrdvsddwqagdlvvekrprviqypeaktrlaitkvmynwvkqqp
    vvipgyegktplfnifdkvrkewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyyk
    kewhkfidtitdhmtevpvitadgevyirngqrgsgqpdtsagnsmlnvltmmyafcest
    gvpyksfnrvarihvcgddgflitekglglkfankgmqilheagkpqkitegekmkvayr
    fediefcshtpvpvrwsdntsshmagrdtavilskmatrldssgergttayekavafsfl
    lmyswnplvrricllvlsqqpetdpskhatyyykgdpigaykdvigrnlselkrtgfekl
    anlnlslstlgvwtkhtskriiqdcvaigkeegnwlvkpdrlissktghlyipdkgftlq
    gkhyeqlql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s48A (A:)
    virehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhqigtimssagirle
    klpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqptlkhtygevtweq
    leagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyyetaipknekrdvsd
    dwqagdlvvekrprviqypeaktrlaitkvmynwvkqqpvvipgyegktplfnifdkvrk
    ewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfidtitdhmtevpvit
    adgevyirngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfnrvarihvcgddgf
    litekglglkfankgmqilheagkpqkitegekmkvayrfediefcshtpvpvrwsdnts
    shmagrdtavilskmatrldssgergttayekavafsfllmyswnplvrricllvlsqqp
    etdpskhatyyykgdpigaykdvigrnlselkrtgfeklanlnlslstlgvwtkhtskri
    iqdcvaigkeegnwlvkpdrlissktghlyipdkgftlqgkhyeqlql