PDB entry 1s44

View 1s44 on RCSB PDB site
Description: The structure and refinement of apocrustacyanin C2 to 1.6A resolution and the search for differences between this protein and the homologous apoproteins A1 and C1.
Class: protein binding
Keywords: Crustacyanin, refinement, post-translational modifications, glycerol
Deposited on 2004-01-15, released 2004-04-27
The last revision prior to the SCOP 1.75 freeze date was dated 2004-06-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.205
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: crustacyanin a1 subunit
    Species: Homarus gammarus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1s44a_
  • Chain 'B':
    Compound: crustacyanin a1 subunit
    Species: Homarus gammarus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1s44b_
  • Heterogens: SO4, GOL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s44A (A:)
kipnfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk
qfvikstgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc
idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s44B (B:)
kipnfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk
qfvikstgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc
idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktv